UBE2Q2 Rabbit pAb, Unconjugated

Product Overview

• Article Name: UBE2Q2 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A9992
• Supplier Catalog Number: A9992
• Alternative Catalog Number: ABB-A9992-100UL,ABB-A9992-20UL,ABB-A9992-500UL,ABB-A9992-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: UBE2Q2

Product Description

Enables ubiquitin-protein transferase activity. Involved in protein K48-linked ubiquitination. Predicted to be located in cytosol. Predicted to be active in nucleus.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 43kDa
• NCBI: 92912
• UniProt: Q8WVN8
• Purity: Affinity purification
• Sequence: MSVSGLKAELKFLASIFDKNHERFRIVSWKLDELHCQFLVPQQGSPHSLPPPLTLHCNITESYPSSSPIWFVDSEDPNLTSVLERLEDTKNNNLLRQQLKWLICELCSLYNLPKHLDVEMLDQPLPTGQNGTTEEVTSEEEEEEEEMAED
• Target: UBE2Q2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse, ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Ubiquitin,Ubiquitin-Proteasome Signaling Pathway.

Images

Western blot analysis of various lysates using UBE2Q2 Rabbit pAb (A9992) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.