beta-Actin Rabbit pAb, Unconjugated

Product Overview

• Article Name: beta-Actin Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-AC006
• Supplier Catalog Number: AC006
• Alternative Catalog Number: ABB-AC006-200UL,ABB-AC006-100UL,ABB-AC006-50UL,ABB-AC006-500UL,ABB-AC006-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: BRWS1, PS1TP5BP1, beta-Actin

Product Description

This gene encodes one of six different actin proteins. Actins are highly conserved proteins that are involved in cell motility, structure, integrity, and intercellular signaling. The encoded protein is a major constituent of the contractile apparatus and one of the two nonmuscle cytoskeletal actins that are ubiquitously expressed. Mutations in this gene cause Baraitser-Winter syndrome 1, which is characterized by intellectual disability with a distinctive facial appearance in human patients. Numerous pseudogenes of this gene have been identified throughout the human genome.

Product Properties

• Clonality: Polyclonal
• Concentration: WB
• Molecular Weight: 42 kDa
• NCBI: 60
• UniProt: P60709
• Purity: Affinity purification
• Sequence: MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERF
• Target: ACTB
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:10000 - 1:100000
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Microfilaments,Death Receptor Signaling Pathway,Endocrine Metabolism,Mitochondrial metabolism,Immunology Inflammation.

Images

Western blot analysis of various lysates using beta-Actin Rabbit pAb (AC006) at 1:125000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30 s.