Phospho-RPS6KA5-T581 Rabbit pAb, Unconjugated

Product Overview

• Article Name: Phospho-RPS6KA5-T581 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-AP1197
• Supplier Catalog Number: AP1197
• Alternative Catalog Number: ABB-AP1197-20UL,ABB-AP1197-100UL,ABB-AP1197-1000UL,ABB-AP1197-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: MSK1, RLPK, MSPK1, Phospho-RPS6KA5-T581

Product Description

Enables ATP binding activity and protein serine/threonine kinase activity. Involved in several processes, including histone-serine phosphorylation, positive regulation of histone modification, and regulation of transcription, DNA-templated. Located in cytoplasm and nucleoplasm.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 90kDa
• NCBI: 9252
• UniProt: O75582
• Purity: Affinity purification
• Sequence: KTPCFTLHYAAPELLNQNGYDESCDLWSLGVILYTMLSGQVPFQSHDRSLTCTSAVEIMKKIKKGDFSFEGEAWKNVSQEAKDLIQGLLTVDPNKRLKMSGLRYNEWLQDGSQLSSNPLMTPDILGSSGAAVHTCVKATFHAFNKYKREGFCLQNVDKAPLAKRRKMKKTSTSTETRSSSSESSHSSSSHSHGKTTPTKTLQPSNPADSNNPETLFQFSDSVA
• Target: RPS6KA5
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Rat, ResearchArea: Epigenetics Nuclear Signaling,Epigenetic writers and erasers of core Histones,Protein phosphorylation,Signal Transduction,G protein signaling,G-Protein-Coupled Receptors Signaling to MAPK Erk,Kinase,Serine threonine kinases,Tyrosine kinases,MAPK-Erk Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Mitochondrial Control of Apoptosis,Inhibition of Apoptosis,Endocrine Metabolism,Immunology Inflammation,NF-kB Signaling Pathway.

Images

Western blot analysis of lysates from C6 cells usingPhospho-RPS6KA5-T581 Rabbit pAb (AP1197) at1:1000 dilution. C6 cells were treated with Calyculin A (100 nM) at 37°C for 30 minutes after serum-starvation overnight.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:60s.