Recombinant Human TNFRSF25/DR3 Protein

Catalog Number: ABB-RP00464
Article Name: Recombinant Human TNFRSF25/DR3 Protein
Biozol Catalog Number: ABB-RP00464
Supplier Catalog Number: RP00464
Alternative Catalog Number: ABB-RP00464-100UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Met1-Gln199
Alternative Names: TNFRSF25,APO-3,DDR3,DR3,LARD,TNFRSF12,TR3,TRAMP,WSL-1,WSL-LR
This protein is a member of the TNF-receptor superfamily. This receptor is expressed preferentially in the tissues enriched in lymphocytes, and it may play a role in regulating lymphocyte homeostasis. This receptor has been shown to stimulate NF-kappa B activity and regulate cell apoptosis. The signal transduction of this receptor is mediated by various death domain containing adaptor proteins. Knockout studies in mice suggested the role of this gene in the removal of self-reactive T cells in the thymus. Multiple alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported, most of which are potentially secreted molecules. The alternative splicing of this gene in B and T cells encounters a programmed change upon T-cell activation, which predominantly produces full-length, membrane bound isoforms, and is thought to be involved in controlling lymphocyte proliferation induced by T-cell activation.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 45.9 kDa
NCBI: 8718
UniProt: Q93038
Purity: 95 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Sequence: MEQRPRGCAAVAAALLLVLLGARAQGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVECQVSQCVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCPTSTLGSCPERCAAVCGWRQ
Target: TNFRSF25
Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Application Notes: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Immune Checkpoint,TNF family
Recombinant Human TNFRSF25/DR3 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.