Recombinant Human TNFSF7/CD27 Ligand/CD70 Protein

Catalog Number: ABB-RP01129
Article Name: Recombinant Human TNFSF7/CD27 Ligand/CD70 Protein
Biozol Catalog Number: ABB-RP01129
Supplier Catalog Number: RP01129
Alternative Catalog Number: ABB-RP01129-10UG,ABB-RP01129-50UG,ABB-RP01129-20UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Gln39-Pro193
Alternative Names: CD70,CD27L, LPFS3, CD27-L, CD27LG, TNFSF7, TNLG8A,CD27-L,CD27LG,TNFSF7,TNLG8A
This protein is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF27/CD27. It is a surface antigen on activated, but not on resting, T and B lymphocytes. It induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation. This cytokine is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 43.09 kDa
NCBI: 970
UniProt: P32970
Purity: 90 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution PBS, pH 7.4.Contact us for customized product form or formulation.
Sequence: QRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Target: TNFSF7/CD27 Ligand
Application Dilute: Lyophilized from a 0.22 µm filtered solution PBS, pH 7.4.Contact us for customized product form or formulation.
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Immune Checkpoint,CAR-T Cell Therapy Targets,Bio-Markers & CD Antigens,TNF family,Biosimilar Drug Targets
Recombinant Human TNFSF7/CD27 Ligand/CD70 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.