Recombinant Human IGF1R/CD221 Protein

Catalog Number: ABB-RP01143
Article Name: Recombinant Human IGF1R/CD221 Protein
Biozol Catalog Number: ABB-RP01143
Supplier Catalog Number: RP01143
Alternative Catalog Number: ABB-RP01143-50UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Met1-Asn932
Alternative Names: IGF1R,CD221,IGFIR,IGFR,JTK13
This receptor binds insulin-like growth factor with a high affinity. It has tyrosine kinase activity. The insulin-like growth factor I receptor plays a critical role in transformation events. Cleavage of the precursor generates alpha and beta subunits. It is highly overexpressed in most malignant tissues where it functions as an anti-apoptotic agent by enhancing cell survival. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 81 kDa(alpha chain), 23 kDa(beta chain) ,104 kDa(single chain)
NCBI: 3480
UniProt: P08069
Purity: 90 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution PBS Buffer, pH 7.4.Contact us for customized product form or formulation.
Sequence: MKSGSGGGSPTSLWGLLFLSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGYLHILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIFEMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGDLCPGTMEEKPMCEKTTINNEYNYRCWTTNRCQKMCPSTCGKRACTENNECCHPECLGSCSAPDNDTACVACRHYY
Target: IGF1R/CD221
Application Dilute: Lyophilized from a 0.22 µm filtered solution PBS Buffer, pH 7.4.Contact us for customized product form or formulation.
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Bio-Markers & CD Antigens,Growth Factor,Biosimilar Drug Targets
Recombinant Human IGF1R/CD221 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.