Recombinant TYRP1 Protein, Human

Catalog Number: ABB-RP01295
Article Name: Recombinant TYRP1 Protein, Human
Biozol Catalog Number: ABB-RP01295
Supplier Catalog Number: RP01295
Alternative Catalog Number: ABB-RP01295-50UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Met1-Arg471
Alternative Names: TRP, CAS2, CATB, GP75, OCA3, TRP1, TYRP, b-PROTEIN,TYRP1
Tyrosinase-related protein 1, also known as TYRP1 or TRP1, is a melanosomal enzyme that belongs to the tyrosinase family and plays an important role in the melanin biosynthetic pathway. Mutations in this enzyme are the cause of rufous oculocutaneous albinism and oculocutaneous albinism type III. TYRP1 / TRP1 is involved in the oxidation of 5,6-dihydroxyindole-2-carboxylic acid (DHICA) into indole-5,6-quinone-2-carboxylic acid. This enzyme may regulate or influence the type of melanin synthesized. The expression of Tyrosinase-related protein 1 (TYRP1) is regulated by the microphthalmia-associated transcription factor (MITF). There is mounting evidence demonstrating that in addition to its role in eumelanin synthesis, TYRP1 is involved in maintaining stability of tyrosinase proliferation and melanocyte cell death.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 52.2 kDa
NCBI: 7306
UniProt: P17643
Purity: 95 % as determined by SDS-PAGE.
Form: Lyophilized from sterile PBS, pH 7.4
Sequence: MSAPKLLSLGCIFFPLLLFQQARAQFPRQCATVEALRSGMCCPDLSPVSGPGTDRCGSSSGRGRCEAVTADSRPHSPQYPHDGRDDREVWPLRFFNRTCHCNGNFSGHNCGTCRPGWRGAACDQRVLIVRRNLLDLSKEEKNHFVRALDMAKRTTHPLFVIATRRSEEILGPDGNTPQFENISIYNYFVWTHYYSVKKTFLGVGQESFGEVDFSHEGPAFLTWHRYHLLRLEKDMQEMLQEPSFSLPYWNFATGK
Target: TRP1
Application Dilute: Lyophilized from sterile PBS, pH 7.4
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Other Recombinant Protein
Recombinant TRP1 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.