Recombinant Mouse CXCL2/MIP-2 Protein, Yeast

Catalog Number: ABB-RP01882
Article Name: Recombinant Mouse CXCL2/MIP-2 Protein, Yeast
Biozol Catalog Number: ABB-RP01882
Supplier Catalog Number: RP01882
Alternative Catalog Number: ABB-RP01882-50UG,ABB-RP01882-500UG,ABB-RP01882-20UG,ABB-RP01882-10UG,ABB-RP01882-100UG,ABB-RP01882-1000UG
Manufacturer: ABclonal
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Mouse
Immunogen: Ala28-Asn100
Alternative Names: Cxcl2, Mip-2, Mip2, Scyb2,C-X-C motif chemokine 2, Macrophage inflammatory protein 2, MIP2
Macrophage Inflammatory Protein-2 (MIP-2) was originally identified as a heparin-binding protein secreted from a murine macrophage cell line in response to endotoxin stimulation. Based on its protein and DNA sequences, MIP-2 is a member of the alpha (C-X-C) subfamily of chemokines. MIP-2 cDNA encodes a 100 amino acid residue precursor protein from which the amino-terminal 27 amino acid residues are cleaved to generate the mature MIP-2. The protein sequence of murine MIP-2 shows approximately 63% identity to that of murine KC, another murine alpha chemokine whose expression is induced by PDGF. In addition, the protein sequence of MIP-2 is also 60% identical to human GRO beta and GRO gamma. It has been suggested that mouse KC and MIP-2 are the homologs of the human GROs and rat CINCs. Similarly to other alpha chemokines, murine MIP-2 is a potent neutrophil attractant and activator. MIP-2 and KC can bind the murine interleukin 8 type B receptor homologue with high affinity. The expression of MIP-2 was found to be associated with neutrophil influx in pulmonary inflammation and glomerulonephritis, suggesting that MIP-2 may contribute to the pathogenesis of inflammatory diseases.
Concentration: < 0.1 EU/µg of the protein by LAL method.
Molecular Weight: 8.62 kDa
NCBI: 20310
UniProt: P10889
Purity: 95 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequence: VVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN
Target: Cxcl2
Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Cytokines & Cytokine receptors