Recombinant Rat Sonic hedgehog N-product/SHH Protein, Human

Catalog Number: ABB-RP01896
Article Name: Recombinant Rat Sonic hedgehog N-product/SHH Protein, Human
Biozol Catalog Number: ABB-RP01896
Supplier Catalog Number: RP01896
Alternative Catalog Number: ABB-RP01896-500UG,ABB-RP01896-50UG,ABB-RP01896-20UG,ABB-RP01896-10UG,ABB-RP01896-100UG,ABB-RP01896-1000UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Rat
Immunogen: Ala24-Gly198
Alternative Names: Shh, Vhh-1, Sonic hedgehog protein, SHH, 3.1.-.-, Shh unprocessed N-terminal signaling and C-terminal autoprocessing domains, ShhNC, Cleaved into: Sonic hedgehog protein N-product, ShhN, Shh N-terminal processed signaling domains, ShhNp
Sonic Hedgehog Protein (SHH, VHH-1) belongs to hedgehog protein family which includes Indian Hh, and Desert Hh. Hh family is involved in the cell fate and patterning during embryonic development, homeostasis, and adult tissue renewal . Similar to other member in the family, SHH binds to the patched (PTC) cell surface receptor, releasing the signal transducer Smoothened (Smo) to transmit the Hh signal into the cell and activate transcription of the target gene . Precursor SHH is autocatlytically cleaved into two subunits, N-terminal and C-terminal products. Soluble N-terminal product is involved in the signaling activity, while C-product displays an autoproteolysis activity on the precursor and a cholesterol transferase activity on the N-terminal product. C-terminal product attaches a cholesterol moiety to the N-terminal product, preventing N-terminal product diffusion within the developing embryo . A defect in SHH has been linked in holoprosencephaly type 3 (HPE3), in which developing forebrain fails to separate into right and left hemispheres, and ocular coloboma .
Concentration: < 0.1 EU/µg of the protein by LAL method.
Molecular Weight: 20.53 kDa
NCBI: 29499
UniProt: Q63673
Purity: 90% as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequence: ACGPGRGFGKRQHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKARIHCSVKAENSVAAKSDG
Target: Shh
Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Cytokines & Cytokine receptors,Cell Culture related