Recombinant Rat Thrombopoietin /THPO / TPO Protein, Human

Catalog Number: ABB-RP01901
Article Name: Recombinant Rat Thrombopoietin /THPO / TPO Protein, Human
Biozol Catalog Number: ABB-RP01901
Supplier Catalog Number: RP01901
Alternative Catalog Number: ABB-RP01901-10UG,ABB-RP01901-50UG,ABB-RP01901-500UG,ABB-RP01901-20UG,ABB-RP01901-100UG,ABB-RP01901-1000UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Rat
Immunogen: Ser22-Ser326
Alternative Names: Megakaryocyte colony-stimulating factor, Megakaryocyte growth and development factor, megakaryocyte stimulating factor, MGDF, MGDFC-mpl ligand, MKCSF, MK-CSF, ML, MPL ligand, MPLLG, MPLLGMGC163194, Myeloproliferative leukemia virus oncogene ligand, THCYT1, THPO, thrombopoietin nirs variant 1, Thrombopoietin, Tpo, TPOMKCSF
Thrombopoietin (Tpo), is a key regulator of megakaryocytopoiesis and thrombopoiesis. It is principally produced in the liver and is bound and internalized by the receptor Tpo R/c mpl. Defects in the Tpo Tpo R signaling pathway are associated with a variety of platelet disorders . Mature rat Tpo shares 68% and 81% aa sequence homology with human and mouse Tpo, respectively . It is an 80 85 kDa protein that consists of an N terminal domain with homology to Erythropoietin (Epo) and a C terminal domain that contains multiple N linked and O linked glycosylation sites. Tpo promotes the differentiation, proliferation, and maturation of megakaryocytes (MK) and their progenitors . Several other cytokines can also promote these functions but only in cooperation with Tpo . Notably, IL 3 independently induces MK development, although its effects are restricted to early in the MK lineage . Tpo additionally promotes platelet production, aggregation, ECM adhesion, and activation . These actions, in combination with direct effects on cardiomyocytes, can aid in the recovery of heart function following myocardial infarction . Tpo is cleaved by platelet derived thrombin following Arg191 within the C terminal domain and subsequently at other sites upon extended digestion . The C terminal domain is not required for binding to Tpo R or inducing MK growth and differentiation . Aside from its hematopoietic effects, Tpo is expressed in the brain where it promotes the apoptosis of hypoxia sensitized neurons and inhibits neuronal differentiation by blocking NGF induced signaling .
Concentration: < 0.01 EU/µg of the protein by LAL method
Molecular Weight: 33.10 kDa
NCBI: 81811
UniProt: P49745
Purity: 95% as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequence: SPVPPACDPRLLNKLLRDSYLLHSRLSQCPDVNPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPPQGRTTAHKDPSALFLSLQQLLRGKVRFLLLVEGPALCVRRTLPTTAVPSRTSQLLTLNKFPNRTSGLLETNFSVVARTAGPGLLNRLQGFRAKIIPGQLNQTSGSLDQIPGYLNGTHEPVNGTHGLFAGTSLQTLEAPDVV
Target: THPO
Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Cytokines & Cytokine receptors