Recombinant Mouse CCL11/Eotaxin Protein, Yeast

Catalog Number: ABB-RP01904
Article Name: Recombinant Mouse CCL11/Eotaxin Protein, Yeast
Biozol Catalog Number: ABB-RP01904
Supplier Catalog Number: RP01904
Alternative Catalog Number: ABB-RP01904-20UG,ABB-RP01904-10UG,ABB-RP01904-100UG,ABB-RP01904-1000UG,ABB-RP01904-50UG,ABB-RP01904-500UG
Manufacturer: ABclonal
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Mouse
Immunogen: His24-Pro97
Alternative Names: Ccl11, Scya11,Eotaxin, C-C motif chemokine 11, Eosinophil chemotactic protein, Small-inducible cytokine A11
CCL11 is a potent eosinophil chemoattractant that was originally purified from bronchoalveolar lavage fluid of guinea pigs sensitized by aerosol challenge with ovalbumin. Microsequencing of the purified protein revealed the guinea pig CCL11 to be a member of the beta (CC) chemokine family of inflammatory and immunoregulatory cytokines. cDNA clones for guinea pig, mouse and human CCL11 have been isolated. Mouse CCL11 cDNA encodes a 97 amino acid residue precursor protein from which the amino-terminal 23 amino acid residues are cleaved to generate the 74 amino acid residue mature mouse CCL11. At the protein sequence level, mature mouse CCL11 is approximately 60% identical to mature human and guinea pig CCL11. In addition, mouse CCL11 also shows high amino acid sequence identity to members of the MCP family. Mouse CCL11 is chemotactic for eosinophils, but not mononuclear cells or neutrophils. CCL11 mRNA is expressed in a variety of tissues. The expression of CCL11 mRNA is induced in cultured endothelial cells in response to IFN-gamma. In addition, CCL11 mRNA is also induced in response to the transplantation of IL-4-secreting tumor cells.
Concentration: < 0.1 EU/µg of the protein by LAL method.
Molecular Weight: 9.28 kDa
NCBI: 20292
UniProt: P48298
Purity: 95% as determined by SDS-PAGE.
Form: Lyophilized from 0.22 µm filtered solution in PBS,250mM NaCl,pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.
Sequence: HPGSIPTSCCFIMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTRLGKEICADPKKKWVQDATKHLDQKLQTPKP
Target: Ccl11
Application Dilute: Lyophilized from 0.22 µm filtered solution in PBS,250mM NaCl,pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Cytokines & Cytokine receptors,Cell Culture related