Recombinant Mouse CCL22/MDC Protein, Yeast

Catalog Number: ABB-RP01906
Article Name: Recombinant Mouse CCL22/MDC Protein, Yeast
Biozol Catalog Number: ABB-RP01906
Supplier Catalog Number: RP01906
Alternative Catalog Number: ABB-RP01906-10UG,ABB-RP01906-100UG,ABB-RP01906-50UG,ABB-RP01906-500UG,ABB-RP01906-20UG,ABB-RP01906-1000UG
Manufacturer: ABclonal
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Mouse
Immunogen: Gly25-Ser92
Alternative Names: Ccl22, Abcd1, Scya22,C-C motif chemokine 22, Activated B and dendritic cell-derived, CC chemokine ABCD-1, Small-inducible cytokine A22
CCL22 may play a role in the trafficking of activated/effector T-lymphocytes to inflammatory sites and other aspects of activated T-lymphocyte physiology. Also, it is a chemotactic for monocytes. dendritic cells and natural killer cells. CCL22 is a mild chemoattractant for primary activated T-lymphocytes and a potent chemoattractant for chronically activated T-lymphocytes but has no chemattractant activity for neutrophils, eosinophils, and resting T-lymphocytes.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 8.68 kDa
NCBI: 20299
UniProt: O88430
Purity: 90% as determined by SDS-PAGE.
Form: Lyophilized from 0.22 µm filtered solution in PBS, 0.2 M Arginine, pH7.4. Normally 8% trehalose is added as protectant before lyophilization.
Sequence: GPYGANVEDSICCQDYIRHPLPSRLVKEFFWTSKSCRKPGVVLITVKNRDICADPRQVWVKKLLHKLS
Target: Ccl22
Application Dilute: Lyophilized from 0.22 µm filtered solution in PBS, 0.2 M Arginine, pH7.4. Normally 8% trehalose is added as protectant before lyophilization.
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Cytokines & Cytokine receptors,Cell Culture related