Recombinant Rat CXCL1/GRO-alpha Protein, Human

Catalog Number: ABB-RP01917
Article Name: Recombinant Rat CXCL1/GRO-alpha Protein, Human
Biozol Catalog Number: ABB-RP01917
Supplier Catalog Number: RP01917
Alternative Catalog Number: ABB-RP01917-10UG,ABB-RP01917-100UG,ABB-RP01917-1000UG,ABB-RP01917-50UG,ABB-RP01917-500UG,ABB-RP01917-20UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Rat
Immunogen: Gly24-Lys96
Alternative Names: Gro1, CINC-1,rRtGRO-alpha/CXCL1, Growth-regulated alpha protein, C-X-C motif chemokine 1, CINC-1
CXCL1, also known as KC, GRO alpha, and CINC-1, is an approximately 8 kDa proinflammatory chemokine that plays a key role in neutrophil migration and activation. Mature human CXCL1 shares 64% and 67% aa sequence identity with mouse and rat CXCL1, respectively. It is produced by many cell types in inflammatory sites and during chronic inflammatory diseases. CXCL1 can associate into bioactive dimers and primarily signals through CXCR2/IL-8 RB but can also bind with lower affinity to CXCR2/IL-8 RA. It induces neutrophil migration, extravasation, respiratory burst, and degranulation and also induces T cells to produce proinflammatory IL-17. CXCL1 additionally binds to Syndecan-1 on epithelial cells which acts as a sink for CXCL1 activity until Syndecan-1 cleavage by MMP-7. CXCL1 is up-regulated in spinal cord astrocytes by inflammatory stimuli or tumor cell injection, and it exacerbates pain sensation by potentiating excitatory NMDA neurotransmission. In the circulatory system, CXCL1 interacts with CXCR2 on endothelial cells to promote lymphatic tube formation and angiogenesis . It promotes the hypertrophic differentiation of chondrocytes resulting in cartilage matrix deposition, calcification, and remodeling. It interacts with both CXCR1 and CXCR2 on adipose stromal cells and promotes their recruitment to prostate tumors in obese patients.. It also binds CXCR2 on ovarian cancer cells, leading to cleavage of cell surface HB-EGF, transactivation of EGF R, and cell proliferation.
Concentration: < 0.1 EU/µg of the protein by LAL method.
Molecular Weight: 10.56 kDa
NCBI: 81503
UniProt: P14095
Purity: 95% as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequence: GAPVANELRCQCLQTVAGIHFKNIQSLKVMPPGPHCTQTEVIATLKNGREACLDPEAPMVQKIVQKMLKGVPK
Target: CXCL1
Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Cytokines & Cytokine receptors