Recombinant Mouse CXCL4/PF-4 Protein, Yeast

Catalog Number: ABB-RP01924
Article Name: Recombinant Mouse CXCL4/PF-4 Protein, Yeast
Biozol Catalog Number: ABB-RP01924
Supplier Catalog Number: RP01924
Alternative Catalog Number: ABB-RP01924-50UG,ABB-RP01924-500UG,ABB-RP01924-10UG,ABB-RP01924-100UG,ABB-RP01924-20UG,ABB-RP01924-1000UG
Manufacturer: ABclonal
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Mouse
Immunogen: Val30-Ser105
Alternative Names: Pf4, Cxcl4, Scyb4,Platelet factor 4, PF-4, C-X-C motif chemokine 4
CXCL4/PF-4,Chemokine released during platelet aggregation that plays a role in different biological processes including hematopoiesis, cell proliferation, differentiation, and activation. Acts via different functional receptors including CCR1, CXCR3A or CXCR3B. Upon interaction with CXCR3A receptor, induces activated T-lymphocytes migration mediated via downstream Ras/extracellular signal-regulated kinase (ERK) signaling. Neutralizes the anticoagulant effect of heparin by binding more strongly to heparin than to the chondroitin-4-sulfate chains of the carrier molecule. Plays a role in the inhibition of hematopoiesis and in the maintenance of hematopoietic stem cell (HSC) quiescence. Chemotactic for neutrophils and monocytes via CCR1. Inhibits endothelial cell proliferation. In cooperation with toll-like receptor 8/TLR8, induces chromatin remodeling and activates inflammatory gene expression via the TBK1-IRF5 axis. In addition, induces myofibroblast differentiation and collagen synthesis in different precursor cells, including endothelial cells, by stimulating endothelial-to-mesenchymal transition.
Concentration: < 0.1 EU/µg of the protein by LAL method.
Molecular Weight: 9.04 kDa
NCBI: 56744
UniProt: Q9Z126
Purity: 90 % as determined by SDS-PAGE.
Form: Lyophilized from 0.22 µm filtered solution in 20mM pb,150mM Nacl ,1mM EDTA (pH 6.0). Normally 8% trehalose is added as protectant before lyophilization.
Sequence: VTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES
Target: CXCL4/PF-4
Application Dilute: Lyophilized from 0.22 µm filtered solution in 20mM pb,150mM Nacl ,1mM EDTA (pH 6.0). Normally 8% trehalose is added as protectant before lyophilization.
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Cytokines & Cytokine receptors,Cell Culture related