Recombinant Rat ALK-1/ACVRL1 Protein, Human

Catalog Number: ABB-RP01925
Article Name: Recombinant Rat ALK-1/ACVRL1 Protein, Human
Biozol Catalog Number: ABB-RP01925
Supplier Catalog Number: RP01925
Alternative Catalog Number: ABB-RP01925-500UG,ABB-RP01925-20UG,ABB-RP01925-50UG,ABB-RP01925-10UG,ABB-RP01925-100UG,ABB-RP01925-1000UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Rat
Immunogen: Lys21-Ala118
Alternative Names: Acvrl1, Acvrlk1,Serine/threonine-protein kinase receptor R3, SKR3, 2.7.11.30, TGF-B superfamily receptor type I, TSR-I
ALK-1/ACVRL1,Type I receptor for TGF-beta family ligands BMP9/GDF2 and BMP10 and important regulator of normal blood vessel development. On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. May bind activin as well.
Concentration: < 0.01 EU/µg of the protein by LAL method
Molecular Weight: 36.97 kDa
NCBI: 25237
UniProt: P80203
Purity: 90 % as determined by SDS-PAGE.
Form: Lyophilized from 0.22 µm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
Sequence: KGDLVKPSRGQLVNCTCENPHCKRPICQGAWCTVVLVREQGRHPQVYRGCGSLNQELCLGRPTEFVNHHCCYRSFCNHNVSLMLEATQTPSEEPEVDA
Target: Acvrl1
Application Dilute: Lyophilized from 0.22 µm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Other Recombinant Protein