Recombinant Mouse Ephrin-B3/EFNB3 Protein, Human

Catalog Number: ABB-RP01926
Article Name: Recombinant Mouse Ephrin-B3/EFNB3 Protein, Human
Biozol Catalog Number: ABB-RP01926
Supplier Catalog Number: RP01926
Alternative Catalog Number: ABB-RP01926-20UG,ABB-RP01926-50UG,ABB-RP01926-10UG,ABB-RP01926-100UG,ABB-RP01926-1000UG,ABB-RP01926-500UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Mouse
Immunogen: Leu28-Ala227
Alternative Names: Ephrin-B3,Efnb3
Ephrin B3 belongs to the ephrin family. Ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. Ephrin B3 is important in brain development as well as in its maintenance. It is especially important for forebrain function since its expression levels were particularly high in several forebrain subregions compared to other brain subregions. Ephrin B3 binds to, and induce the collapse of, commissural axons/growth cones in vitro.
Concentration: < 0.01 EU/µg of the protein by LAL method
Molecular Weight: 47.88 kDa
NCBI: 13643
UniProt: O35393
Purity: 95 % as determined by SDS-PAGE.
Form: Lyophilized from 0.22 µm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
Sequence: SLEPVYWNSANKRFQAEGGYVLYPQIGDRLDLLCPRARPPGPHSSPSYEFYKLYLVEGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEYSPNLWGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKPVSEMPMERDRGAAHSAEPGRDTIPGDPSSNATSRGAEGPLPPPSMPA
Target: Efnb3
Application Dilute: Lyophilized from 0.22 µm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Cytokines & Cytokine receptors,Cell Culture related