Recombinant African swine fever virus P30 Protein, E. coli

Catalog Number: ABB-RP01934LQ
Article Name: Recombinant African swine fever virus P30 Protein, E. coli
Biozol Catalog Number: ABB-RP01934LQ
Supplier Catalog Number: RP01934LQ
Alternative Catalog Number: ABB-RP01934LQ-20UG,ABB-RP01934LQ-10UG,ABB-RP01934LQ-1000UG
Manufacturer: ABclonal
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Virus
Immunogen: Ile86-Lys194
Alternative Names: p30
ASFV structural protein p30 is a significant immunogen reported to induce neutralizing antibodies against it. The p30 interacts with heterologous nuclear ribonucleoprotein K (hnRNPK) in the host cell and could downregulate the host cell mRNA translation (Hernaez et al., 2008). Moreover, p30 is an excellent diagnostic marker for ASFV, and anti-p30 antibodies can be detected as early as eight days post-infection (Gomez-Puertas et al., 1998).We and others previously showed the epitopic domains of the p30 protein, which could potentially generate the host immune response (Afonso et al., 1992, Imdhiyas et al., 2022, Petrovan et al., 2019).
Concentration: Please contact us for more information.
Molecular Weight: 12.66 kDa
NCBI: 34204
UniProt: P34204
Purity: 95 % as determined by SDS-PAGE.
Form: Supplied as 0.22 µm filtered solution in PBS,300 mM NaCl,10% glycerol, (pH 7.4).
Sequence: ILHVLFEEETESSASSENIHEKNDNETNECTSSFETLFEQEPSSEVPKDSKLYMLAQKTVQHIEQYGKAPDFNKVIRAHNFIQTIYGTPLKEEEKEVVRLMVIKLLKKK
Target: p30
Application Dilute: Supplied as 0.22 µm filtered solution in PBS,300 mM NaCl,10% glycerol, (pH 7.4).
Application Notes: ResearchArea: Other Recombinant Protein