Recombinant Human CCL14/HCC-1/HCC-3 Protein

Catalog Number: ABB-RP01940
Article Name: Recombinant Human CCL14/HCC-1/HCC-3 Protein
Biozol Catalog Number: ABB-RP01940
Supplier Catalog Number: RP01940
Alternative Catalog Number: ABB-RP01940-50UG,ABB-RP01940-500UG,ABB-RP01940-20UG,ABB-RP01940-100UG,ABB-RP01940-1000UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Thr20-Asn93
Alternative Names: CCL14, NCC2, SCYA14,C-C motif chemokine 14, Chemokine CC-1/CC-3, HCC-1/HCC-3, HCC-1(1-74), NCC-2, Small-inducible cytokine A14, Cleaved into: HCC-1(3-74), HCC-1(4-74), HCC-1(9-74)
Chemokine (C-C motif) Ligand 14 (CCL14) is a small cytokine belonging to the CC chemokine family. It isproduced as a protein precursor that is processed to generate a mature active protein containing 74 aminoacids that and is 46% identical in amino acid composition to CCL3 and CCL4. This chemokine is expressed invarious tissues including spleen, bone marrow, liver, muscle, and gut. CCL14 activates monocytes, but does notinduce their chemotaxis. Human CCL14 is located on chromosome 17 within a cluster of other chemokinesbelonging to the CC family.
Concentration: < 0.01 EU/µg of the protein by LAL method
Molecular Weight: 9.51 kDa
NCBI: 6358
UniProt: Q16627
Purity: 95 % as determined by SDS-PAGE.
Form: Lyophilized from 0.22 µm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
Sequence: TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN
Target: CCL14
Application Dilute: Lyophilized from 0.22 µm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Cytokines & Cytokine receptors,Cell Culture related