Recombinant Human LH /CGA&LHB Protein

Catalog Number: ABB-RP01942
Article Name: Recombinant Human LH /CGA&LHB Protein
Biozol Catalog Number: ABB-RP01942
Supplier Catalog Number: RP01942
Alternative Catalog Number: ABB-RP01942-1000UG,ABB-RP01942-50UG,ABB-RP01942-500UG,ABB-RP01942-20UG,ABB-RP01942-10UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: (Ala25-Ser116)& ( Ser21-Leu141)
Alternative Names: CGA&LHB,Lutropin alpha chain,&Lutropin beta chain,LSH-alpha&LSH-beta, Luteinizing Hormone alpha/beta Heterodimer
Luteinizing Hormone (LH) is a 42 kDa heterodimer belonging to the glycoprotein hormone family. It is composed of noncovalently linked glycosylated alpha and beta chains. The alpha subunit (CG alpha ) is also a component of Follicle-Stimulating Hormone (FSH), Thyroid-Stimulating Hormone, and Chorionic Gonadotropin. The unique beta subunit confers the proteins specific biological action and is responsible for the interaction with its receptor . The approximately 20 kDa human CG alpha subunit shares 73% and 72% amino acid (aa) sequence identity with the mouse and rat orthologs, respectively. The approximately 18 kDa human LH beta subunit shares 71% and 72% aa sequence identity with the mouse and rat orthologs, respectively. Multiple isoforms of LH exist due to differences in the post-translational glycosylation, sialylation, and sulphation modifications of its subunits . The composition, longevity, and activity of the different LH isoforms vary throughout a womans menstrual cycle and reproductive life cycle. LH is produced and secreted by the anterior pituitary gland. Its secretion is controlled by Gonadotropin-Releasing Hormone from the hypothalamus, however, LH secretion can also be stimulated by estradiol . LH works in concert with FSH to regulate female reproduction, FSH stimulates follicular growth and LH induces ovulation. LH also drives formation of the corpus luteum by promoting progesterone production. Additionally, LH has been suggested to stimulate the adrenal gland in postmenopausal women to induce secretion of sulfated DHEA, a precursor to androgens. In the testis, LH induces Leydig cell production of testosterone. Hypersecretion of LH has been shown to occur in women with polycystic ovary syndrome and is associated with an increased risk of infertility and miscarriage). Additionally, increased serum LH levels are associated with decreased cognition and have been implicated in the development and progression of Alzheimers disease.
Concentration: < 0.1 EU/µg of the protein by LAL method.
Molecular Weight: 26.04 kDa
NCBI: 1081
UniProt: P01215
Purity: 95 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequence: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS&amp;SREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLPPLPQVVCTYRDVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLFL
Target: CGA&amp;LHB
Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Application Notes: Cross-Reactivity: Centrifµge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Cytokines & Cytokine receptors