Recombinant Mouse NCAM-1/CD56 Protein, Human

Catalog Number: ABB-RP01943
Article Name: Recombinant Mouse NCAM-1/CD56 Protein, Human
Biozol Catalog Number: ABB-RP01943
Supplier Catalog Number: RP01943
Alternative Catalog Number: ABB-RP01943-10UG,ABB-RP01943-100UG,ABB-RP01943-50UG,ABB-RP01943-500UG,ABB-RP01943-1000UG,ABB-RP01943-20UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Mouse
Immunogen: Leu20-Thr711
Alternative Names: Ncam1, Ncam,Neural cell adhesion molecule 1, N-CAM-1, NCAM-1, CD56
Neural cell adhesion molecule 1 (NCAM-1, also CD56) is a membrane-bound glycoprotein that plays an important role in nervous system development and function. Mature mouse NCAM-1 consists of a 692 amino acid (aa) extracellular domain (ECD) with five tandem Ig-like domains and two fibronectin type III domains, an 18 aa transmembrane segment, and a 386 aa cytoplasmic domain . Three major splice variants of NCAM-1 are expressed: the 180 kDa full length NCAM-180 isoform, the 140 kDa NCAM-140 isoform which lacks most of the cytoplasmic domain, and the 120 kDa GPI-anchored NCAM-120 isoform that includes the ECD only. Splicing is tissue specific and developmentally regulated . Within the ECD, mouse NCAM-1 shares 94% and 95% aa sequence identity with human and rat NCAM-1, respectively. It is expressed on neurons and glial cells, skeletal muscle, and immune NK cells . NCAM-1 is extensively modified with polysialic acid (PSA) during development, but this addition is decreased in adult tissues . Polysialylation of NCAM-1 is retained in the adult hippocampus where it is important for synaptic plasticity and memory formation . The PSA moiety also participates in the binding of NCAM-1 to heparan sulfate proteoglycans and NCAM-1 mediated migration of olfactory neurons . Proteolytic shedding of NCAM-1 liberates a soluble ECD fragment that can inhibit cortical neurite branching and growth . The NCAM-140 isoform is preferentially expressed on NK cells that robustly secrete cytokines upon activation. Selective up-regulation of the NCAM-140 isoform in a variety of tumors initiates epithelial-mesenchymal transition (EMT) and promotes tumor cell invasion . Finally, NCAM-1 is known to interact with a number of transmembrane and extracellular molecules. NK cell NCAM-1 binds to T cell FGF R1, co-stimulating IL-2 production by T cells. NCAM-1 also forms a noncovalent membrane complex with GFR alpha 1, 2 and 4, generating a receptor for GDNF, NTN and PSP, respectively . And NCAM-1 is reported to form homophilic trans-interactions, and to interact with L1 CAM in cis, and with HSPGs (agrin and collagen XVIII) in trans. In general, these interactions are involved in cell adhesion, migration, and/or process extension .
Concentration: < 0.01 EU/µg of the protein by LAL method
Molecular Weight: 79.31 kDa
NCBI: 17967
UniProt: P13595
Purity: 95 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequence: LQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGEKLSPNQQRISVVWNDDDSSTLTIYNANIDDAGIYKCVVTAEDGTQSEATVNVKIFQKLMFKNAPTPQEFKEGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNVPPTVQARQSIVNATANLGQSVTLVCDADGFPEPTMSWTKDGEPIENEEEDDEKHIFSDDSSELT
Target: Ncam1
Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Application Notes: Cross-Reactivity: Centrifµge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Cytokines & Cytokine receptors