Recombinant Human CR2/CD21 Protein

Catalog Number: ABB-RP01987
Article Name: Recombinant Human CR2/CD21 Protein
Biozol Catalog Number: ABB-RP01987
Supplier Catalog Number: RP01987
Alternative Catalog Number: ABB-RP01987-50UG,ABB-RP01987-500UG,ABB-RP01987-100UG,ABB-RP01987-1000UG,ABB-RP01987-20UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Ile21-Arg971
Alternative Names: CR2, C3DR, Complement receptor type 2, Cr2, Complement C3d receptor, Epstein-Barr virus receptor, EBV receptor, CD21
CD21, also known as Complement component (3d / Epstein Barr virus) receptor 2 and CR2, is a member of the CD system and is a protein involved in complement system. CD21 is present on all mature B-cells and some T-cells and follicular dendritic cells. CD21 on mature B-cells form a complex called the B cell receptor complex with two other membrane proteins, CD19 and CD81. CD21 has a function in the complement system through serving as the cellular receptor specific for ligands such as C3 and C4 which can be attached to foreign macromolecules in order to remove or uptake them. This results in B-cells having enhanced response to the antigen.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 106.85 kDa
NCBI: 1380
UniProt: P20023
Purity: 90 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4.
Sequence: ISCGSPPPILNGRISYYSTPIAVGTVIRYSCSGTFRLIGEKSLLCITKDKVDGTWDKPAPKCEYFNKYSSCPEPIVPGGYKIRGSTPYRHGDSVTFACKTNFSMNGNKSVWCQANNMWGPTRLPTCVSVFPLECPALPMIHNGHHTSENVGSIAPGLSVTYSCESGYLLVGEKIINCLSSGKWSAVPPTCEEARCKSLGRFPNGKVKEPPILRVGVTANFFCDEGYRLQGPPSSRCVIAGQGVAWTKMPVCEEIF
Target: CR2, C3DR
Application Dilute: Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4.
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Bio-Markers & CD Antigens