Recombinant Cynomolgus B7-H1/PD-L1/CD274 Protein, Human

Product Overview

• Article Name: Recombinant Cynomolgus B7-H1/PD-L1/CD274 Protein, Human
• Biozol Catalog Number: ABB-RP02471
• Supplier Catalog Number: RP02471
• Alternative Catalog Number: ABB-RP02471-100UG
• Manufacturer: ABclonal
• Host: Human
• Category: Proteine/Peptide
• Species Reactivity: Monkey
• Immunogen: Phe19-Arg238
• Alternative Names: CD274 antigenMGC142294, CD274 molecule, CD274,PDL1, PD-L1, PD-L1B7 homolog 1,B7-H, B7H1, B7-H1, B7H1PDCD1L1,? PDCD1L1, PDCD1LG1, PDCD1LG1MGC142296,? PDL1PDCD1 ligand 1, programmed cell death 1 ligand 1, Programmed death ligand 1, PDL1

Product Properties

• Concentration: < 1 EU/µg of the protein by LAL method.
• Molecular Weight: 52 kDa
• NCBI: 102145573
• UniProt: G7PSE7
• Purity: 95 % as determined by Tris-Bis PAGE, 95 % as determined by HPLC.
• Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
• Sequence: FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLTSLIVYWEMEDKNIIQFVHGEEDLKVQHSNYRQRAQLLKDQLSLGNAALRITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLLNVTSTLRINTTANEIFYCIFRRLDPEENHTAELVIPELPLALPPNER
• Target: Cynomolgus B7-H1/PD-L1/CD274

Application Notes

• Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
• Application Notes: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Immune Checkpoint