Recombinant Human Siglec-8 Protein

Product Overview

• Article Name: Recombinant Human Siglec-8 Protein
• Biozol Catalog Number: ABB-RP02494
• Supplier Catalog Number: RP02494
• Alternative Catalog Number: ABB-RP02494-10UG, ABB-RP02494-100UG, ABB-RP02494-50UG, ABB-RP02494-20UG
• Manufacturer: ABclonal
• Host: Human
• Category: Proteine/Peptide
• Species Reactivity: Human
• Immunogen: Met17-Ala363
• Alternative Names: Siglec-8,SAF2, SIGLEC-8, SIGLEC8L,SIGLEC8,SIGLEC-8,SIGLEC8L

Product Properties

• Concentration: < 0.01 EU/µg of the protein by LAL method
• Molecular Weight: 38.53 kDa
• NCBI: 27181
• UniProt: Q9NYZ4
• Purity: 95 % as determined by SDS-PAGE.
• Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
• Sequence: EGDRQYGDGYLLQVQELVTVQEGLCVHVPCSFSYPQDGWTDSDPVHGYWFRAGDRPYQDAPVATNNPDREVQAETQGRFQLLGDIWSNDCSLSIRDARKRDKGSYFFRLERGSMKWSYKSQLNYKTKQLSVFVTALTHRPDILILGTLESGHSRNLTCSVPWACKQGTPPMISWIGASVSSPGPTTARSSVLTLTPKPQDHGTSLTCQVTLPGTGVTTTSTVRLDVSYPPWNLTMTVFQGDATASTALGNGSSLS
• Target: Siglec-8/SAF-2

Application Notes

• Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
• Application Notes: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Bio-Markers & CD Antigens