Recombinant Human/Mouse/Rat Mature BMP-4 Protein, Chinese Hamster

Catalog Number: ABB-RP02512S1
Article Name: Recombinant Human/Mouse/Rat Mature BMP-4 Protein, Chinese Hamster
Biozol Catalog Number: ABB-RP02512S1
Supplier Catalog Number: RP02512S1
Alternative Catalog Number: ABB-RP02512S1-10UG,ABB-RP02512S1-100UG,ABB-RP02512S1-1000UG,ABB-RP02512S1-20UG,ABB-RP02512S1-50UG,ABB-RP02512S1-500UG
Manufacturer: ABclonal
Host: Chinese Hamster
Category: Proteine/Peptide
Species Reactivity: Human, Mouse, Rat
Immunogen: Ser293-Arg408
Alternative Names: BMP4, BMP2B, DVR4,Bone morphogenetic protein 4, BMP-4, Bone morphogenetic protein 2B, BMP-2B
Recombinant Human/Mouse/Rat Mature BMP-4 Protein that in humans is encoded by BMP4 gene. BMP4 is a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. BMP4 is highly conserved evolutionarily. BMP4 is found in early embryonic development in the ventral marginal zone and in the eye, heart blood and otic vesicle.
Concentration: < 0.01 EU/µg of the protein by LAL method
Molecular Weight: 13.13 kDa
NCBI: 652
UniProt: P12644
Purity: 95 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of 50mM acetic acid,pH3.6.
Sequence: SPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
Target: BMP4, BMP2B, DVR4
Application Dilute: Lyophilized from a 0.22 µm filtered solution of 50mM acetic acid,pH3.6.
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Cytokines & Cytokine receptors