Recombinant Human FGFR-2 beta (IIIb)/KGFR/CD332 (253-378) Protein

Catalog Number: ABB-RP02529
Article Name: Recombinant Human FGFR-2 beta (IIIb)/KGFR/CD332 (253-378) Protein
Biozol Catalog Number: ABB-RP02529
Supplier Catalog Number: RP02529
Alternative Catalog Number: ABB-RP02529-500UG,ABB-RP02529-100UG,ABB-RP02529-1000UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Pro253-Glu378
Alternative Names: Fibroblast growth factor receptor 2,FGFR-2,KGFR,K-sam,Keratinocyte growth factor receptor,CD332,BEK,KSAM
Four distinct genes encoding closely related FGF receptors, FGF R1 - 4, are known. All four genes for FGF Rs encode proteins with an N-terminal signal peptide, three immunoglobulin (Ig)-like domains, an acid-box region containing a run of acidic residues between the IgI and IgII domains, a transmembrane domain and the split tyrosine-kinase domain. Multiple forms of FGF R1 - 3 are generated by alternative splicing of the mRNAs. A frequent splicing event involving FGF R1 and 2 results in receptors containing all three Ig domains, referred to as the alpha isoform, or only IgII and IgIII, referred to as the beta isoform.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 40.5 kDa
NCBI: 2263
UniProt: P21802
Purity: 95 % as determined by Tris-Bis PAGE, 95 % as determined by HPLC.
Sequence: PHRPILQAGLPANASTVVGGDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKHSGINSSNAEVLALFNVTEADAGEYICKVSNYIGQANQSAWLTVLPKQQAPGREKEITASPDYLE
Target: FGFR2 beta (IIIb)/KGFR/CD332
Application Notes: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Other Recombinant Protein