Recombinant Cynomolgus CRTAM/CD355 Protein, Human

Catalog Number: ABB-RP02611
Article Name: Recombinant Cynomolgus CRTAM/CD355 Protein, Human
Biozol Catalog Number: ABB-RP02611
Supplier Catalog Number: RP02611
Alternative Catalog Number: ABB-RP02611-100UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Monkey
Immunogen: Ser18-Gly287
Alternative Names: CD355 antigen, CD355, CRTAM
Class-I Restricted T Cell-Associated Molecule (CRTAM) is a protein that is expressed after T cell activation. The interaction of CRTAM with its ligand, nectin-like 2 (Necl2), is required for the efficient production of IL-17, IL-22, and IFNgamma by murine CD4 T cells, and it plays a role in optimal CD8 T and NK cell cytotoxicity. CRTAM promotes the pro-inflammatory cytokine profile, therefore, it may take part in the immunopathology of autoimmune diseases such as diabetes type 1 or colitis.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 56.6 kDa
NCBI: 102125896
UniProt: XP_005580021.1
Purity: 95 % as determined by Tris-Bis PAGE, 95 % as determined by HPLC.
Sequence: SLTNHTETITVEEGQTLTLKCVTSLRKSSSLQWLTPSGFTIFLNEYPAFKNSRYQLLHHSANQLSISVSNITLQDEGVYKCLHYSDSVSTKEVKVIVLATPFKPILEASVIRKQNGEEHVVLMCSAMRSKPPPQITWLLGNGVEVSGGTHHEFETDGKKCNTTSTLIIHTYGKNSTVDCIIRHRGLQGRKLVAPFRFEDLVTDEETASDALERNSVSSQDPQQPTSTVSVMEDSSTLEIDKEEKEQTTQDPDLTT
Target: Cynomolgus CRTAM
Application Notes: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein