Recombinant Mouse BAMBI Protein, Human

Catalog Number: ABB-RP02614
Article Name: Recombinant Mouse BAMBI Protein, Human
Biozol Catalog Number: ABB-RP02614
Supplier Catalog Number: RP02614
Alternative Catalog Number: ABB-RP02614-100UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Mouse
Immunogen: Glu27-Ala152
Alternative Names: Nma, Bambi
Bone morphogenic protein and activin membrane-bound inhibitor (BAMBI) is a transmembrane protein that affects the growth, development and muscle regeneration of the body by regulating the TGF-beta, BMP and Wnt signaling pathways. In brief, BAMBI may be a functional gene for the differentiation of bovine preadipocytes and myoblasts, and variations in the BAMBI genomic region, especially the combined haplotype H1H4, may benefit marker-assisted selection in cattle.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 40.7 kDa
NCBI: 68010
UniProt: Q9D0L6
Purity: 95 % as determined by Tris-Bis PAGE, 95 % as determined by HPLC.
Sequence: EIRCYCDAAHCVATGYMCKSELSACFSRLLDPQNTNSPLTHGCLDSLASTADICRAKQAQNHSGPAMPTLECCHEDMCNYRGLHDVLSPSKSEASGQGNRYQHDSSRNLITKMQELTSSKELWFRA
Target: BAMBI
Application Notes: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein