Recombinant Human B7-H7/HHLA2 Protein

Catalog Number: ABB-RP02620
Article Name: Recombinant Human B7-H7/HHLA2 Protein
Biozol Catalog Number: ABB-RP02620
Supplier Catalog Number: RP02620
Alternative Catalog Number: ABB-RP02620-100UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Ile23-Asn344
Alternative Names: B7H7, B7-H7, HHLA2, B7 Homolog 7
B7-H7, also known as HHLA2 (HERV-H LTR-associating 2), is a member of the B7 family of immune regulatory proteins.Through interaction with TMIGD2, costimulates T-cells in the context of TCR-mediated activation. Enhances T-cell proliferation and cytokine production via an AKT-dependent signaling cascade.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 63.7 kDa
NCBI: 11148
UniProt: Q9UM44
Purity: 95 % as determined by Tris-Bis PAGE, 95 % as determined by HPLC.
Sequence: IFPLAFFIYVPMNEQIVIGRLDEDIILPSSFERGSEVVIHWKYQDSYKVHSYYKGSDHLESQDPRYANRTSLFYNEIQNGNASLFFRRVSLLDEGIYTCYVGTAIQVITNKVVLKVGVFLTPVMKYEKRNTNSFLICSVLSVYPRPIITWKMDNTPISENNMEETGSLDSFSINSPLNITGSNSSYECTIENSLLKQTWTGRWTMKDGLHKMQSEHVSLSCQPVNDYFSPNQDFKVTWSRMKSGTFSVLAYYLSS
Target: B7-H7/HHLA2
Application Notes: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein