Recombinant Cynomolgus Fc gamma RIII/CD16 Protein, Human

Product Overview

• Article Name: Recombinant Cynomolgus Fc gamma RIII/CD16 Protein, Human
• Biozol Catalog Number: ABB-RP02640
• Supplier Catalog Number: RP02640
• Alternative Catalog Number: ABB-RP02640-100UG
• Manufacturer: ABclonal
• Host: Human
• Category: Proteine/Peptide
• Species Reactivity: Monkey
• Immunogen: Gly17-Gln208
• Alternative Names: IgG Fc receptor III, Fc-gamma RIII, FcRIII, FCGR3, CD16, CD16A, FCG3, FcgRIII, FCR-10, FCRIIIA, IGFR3, IMD20

Product Description

Immunoglobulin G (IgG) Fc receptors play a critical role in linking IgG antibody-mediated immune responses with cellular effector functions. A high resolution map of the binding site on human IgG1 for human Fc gamma RI, Fc gamma RIIA, Fc gamma RIIB, Fc gamma RIIIA, and FcRn receptors has been determined.A common set of IgG1 residues is involved in binding to all Fc gamma R, Fc gamma RII and Fc gamma RIII also utilize residues outside this common set.

Product Properties

• Concentration: < 1 EU/µg of the protein by LAL method.
• Molecular Weight: 23.1 kDa
• NCBI: 102140945
• UniProt: Q8SPW2
• Purity: 95 % as determined by Tris-Bis PAGE, 95 % as determined by HPLC.
• Sequence: GMRAEDLPKAVVFLEPQWYRVLEKDRVTLKCQGAYSPEDNSTRWFHNESLISSQTSSYFIAAARVNNSGEYRCQTSLSTLSDPVQLEVHIGWLLLQAPRWVFKEEESIHLRCHSWKNTLLHKVTYLQNGKGRKYFHQNSDFYIPKATLKDSGSYFCRGLIGSKNVSSETVNITITQDLAVSSISSFFPPGYQ
• Target: Cynomolgus Fc gamma RIII/CD16

Application Notes

• Application Notes: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein