Recombinant Cynomolgus Glypican-3/GPC3 Protein, Human

Catalog Number: ABB-RP02648
Article Name: Recombinant Cynomolgus Glypican-3/GPC3 Protein, Human
Biozol Catalog Number: ABB-RP02648
Supplier Catalog Number: RP02648
Alternative Catalog Number: ABB-RP02648-100UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Monkey
Immunogen: Gln25-His559
Alternative Names: GPC3, DGSX, Glypican 3, GTR2-2, MXR7, OCI5, OCI-5, SGB, SGBS, SGBS1SDYS, SDYS, SGBS1
Glypican-3 is a protein ,which is encoded by the GPC3 gene in humans.The protein core of GPC3 consists of two subunits, where the N-terminal subunit has a size of ~40 kDa and the C-terminal subunit is ~30 kDa.Glypican 3 is a potential therapeutic target for treating liver cancer and other cancers. Several therapeutic anti-GPC3 antibodies have been developed.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 61.8 kDa
NCBI: 102137748
UniProt: XP_005594665.1
Purity: 95 % as determined by Tris-Bis PAGE, 95 % as determined by HPLC.
Sequence: QPPPPPPDATCHQVRSFFQRLQPGLKWVPETPVPGSDLQVCLPKGPTCCSRKMEEKYQLTARLNMEQLLQSASMELKFLIIQNAAVFQEAFEIVVRHAKNYTNAMFKNNYPSLTPQAFEFVGEFFTDVSLYILGSDINVDDMVNELFDSLFPVIYTQLMNPGLPDSALDINECLRGARRDLKVFGNFPKLIMTQVSKSLQVTRIFLQALNLGIEVINTTDHLKFSKDCGRMLTRMWYCSYCQGLMMVKPCGGYCN
Target: Cynomolgus GPC3/Glypican 3
Application Notes: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein