Recombinant Human IL-15RA&IL-15 Protein

Product Overview

• Article Name: Recombinant Human IL-15RA&IL-15 Protein
• Biozol Catalog Number: ABB-RP02654
• Supplier Catalog Number: RP02654
• Alternative Catalog Number: ABB-RP02654-100UG
• Manufacturer: ABclonal
• Host: Human
• Category: Proteine/Peptide
• Species Reactivity: Human
• Immunogen: Ile31-Ser108(IL-15RA)&Asn49-Ser162(IL-15)
• Alternative Names: IL-15 R alpha,CD215,IL15RA,IL-15RA,IL-15R-alpha1,Interleukin-15,IL-15,IL15

Product Description

Interleukin-15 receptor alpha (IL-15R alpha) is a high affinity IL-15 binding protein that is crucial for mediating IL-15 functions such as memory CD8 T cell proliferation and NK, NK/T cell, and intestinal intraepithelial lymphocyte development.

Product Properties

• Concentration: < 1 EU/µg of the protein by LAL method.
• Molecular Weight: 23.8 kDa
• NCBI: 3601
• UniProt: Q13261
• Purity: 95 % as determined by Tris-Bis PAGE, 95 % as determined by HPLC.
• Sequence: ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
• Target: IL-15RA&amp;IL-15

Application Notes

• Application Notes: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein