Recombinant Human IGFBP-7 Protein

Catalog Number: ABB-RP02738
Article Name: Recombinant Human IGFBP-7 Protein
Biozol Catalog Number: ABB-RP02738
Supplier Catalog Number: RP02738
Alternative Catalog Number: ABB-RP02738-100UG,ABB-RP02738-10UG,ABB-RP02738-20UG,ABB-RP02738-50UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Asp30-Leu282
Alternative Names: IGFBP-7, IBP7, AGM, FSTL2, IGFBP-7v, IGFBPRP1, MAC25, PSF, RAMSVPS, TAF ,IGFBP7,igfbp7
IGFBP-7, also known as Mac25/Angiomodulin (AGM), GFBP-rp1, tumor-derived adhesion factor (TAF) and prostacyclin-stimulating factor (PSF), is a secreted protein that contains three protein domain modules. Human IGFBP-rp1 cDNA encodes 282 amino acid (aa) residue precursor protein with a putative 26 aa signal peptide. IGFBP-7 binds IGF-I and IGF-II with a relatively low affinity. Stimulates prostacyclin (PGI2) production. Stimulates cell adhesion.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 27.02 kDa
Tag: N-His
NCBI: 3490
UniProt: Q16270
Source: HEK293 cells
Purity: 90% as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequence: DTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL
Target: IGFBP-7
Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein