Recombinant Human AMBP Protein

Catalog Number: ABB-RP02794
Article Name: Recombinant Human AMBP Protein
Biozol Catalog Number: ABB-RP02794
Supplier Catalog Number: RP02794
Alternative Catalog Number: ABB-RP02794-10UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Gly20-Val203
Alternative Names: A1M, HCP, ITI, UTI, EDC1, HI30, ITIL, IATIL, ITILC, AMBP
Protein AMBP belongs to the calycin superfamily and Lipocalin family. AMBP can be cleaved into three chains: alpha-1-microglobulin, inter-alpha-trypsin inhibitor light chain and trypstatin. AMBP is expressed by the liver and secreted in plasma. alpha-1-microglobulin occurs in many physiological fluids including the plasma, urine, and cerebrospinal fluid. Inter-alpha-trypsin inhibitor is present in the plasma and urine. alpha-1-microglobulin occurs as a monomer and also in complexes with IgA and albumin, Inter-alpha-trypsin inhibitor inhibits trypsin, plasmin and lysosomal granulocytic elastase. Trypstatin act as a trypsin inhibitor, exists in a monomer forms and also occurs as a complex with tryptase in mast cells.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 21.9 kDa
NCBI: 259
UniProt: P02760
Purity: 95 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequence: GPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRV
Target: AMBP
Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Application Notes: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein