Recombinant Human CFHR4 Protein

Catalog Number: ABB-RP02803
Article Name: Recombinant Human CFHR4 Protein
Biozol Catalog Number: ABB-RP02803
Supplier Catalog Number: RP02803
Alternative Catalog Number: ABB-RP02803-50UG, ABB-RP02803-10UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Glu20-Glu578
Alternative Names: Complement factor H-related protein 4, FHR-4, CFHR4, CFHL4
Complement factor H-related protein 4 is a protein that in humans is encoded by the CFHR4 gene. It is a secreted protein that belongs to the complement factor H protein family. Members of the H-related protein family are exclusively composed of individually folded protein domains. CFHR4 is synthesized as a 578 amino acid precursor that contains an 19 amino acid signal peptide and a 569 amino acid mature chain. Human CFHR4 is involved in complement regulation. It can associate with lipoproteins and may play a role in lipid metabolism.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 64.1 kDa
NCBI: 10877
UniProt: Q92496
Purity: 95 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequence: EVKPCDFPEIQHGGLYYKSLRRLYFPAAAGQSYSYYCDQNFVTPSGSYWDYIHCTQDGWSPTVPCLRTCSKSDVEIENGFISESSSIYILNEETQYNCKPGYATAEGNSSGSITCLQNGWSTQPICIKFCDMPVFENSRAKSNGMWFKLHDTLDYECYDGYESSYGNTTDSIVCGEDGWSHLPTCYNSSENCGPPPPISNGDTTSFPQKVYLPWSRVEYQCQSYYELQGSKYVTCSNGDWSEPPRCISMKPCEFP
Target: CFHR4
Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Application Notes: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein