Recombinant Mouse/Rat Flt4 ligand/VEGF-C Protein, Human

Catalog Number: ABB-RP02804
Article Name: Recombinant Mouse/Rat Flt4 ligand/VEGF-C Protein, Human
Biozol Catalog Number: ABB-RP02804
Supplier Catalog Number: RP02804
Alternative Catalog Number: ABB-RP02804-50UG,ABB-RP02804-20UG,ABB-RP02804-10UG,ABB-RP02804-100UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Mouse, Rat
Immunogen: Ala108-Arg223
Alternative Names: VEGFC,Flt4-L,LMPH1D,VRP,VEGF-C
Vascular endothelial growth factor C (VEGF-C) is a member of the VEGF family. Upon biosynthesis, VEGF-C protein is secreted as a non-covalent momodimer in an anti-parellel fashion. VEGF-C protein is a dimeric glycoprotein, as a ligand for two receptors, VEGFR-3 (Flt4), and VEGFR-2. VEGF-C may function in angiogenesis of the venous and lymphatic vascular systems during embryogenesis. VEGF-C protein is over-expressed in various human cancers including breast cancer and prostate cancer. VEGF-C/VEGFR-3 axis, through different signaling pathways, plays a critical role in cancer progression by regulating different cellular functions, such as invasion, proliferation, and resistance to chemotherapy. Thus, targeting the VEGF-C/VEGFR-3 axis may be therapeutically significant for certain types of tumors.
Concentration: < 0.01 EU/µg of the protein by LAL method
Molecular Weight: 13.89 kDa
Tag: C-His
NCBI: 22341
UniProt: P97953
Source: HEK293 cells
Purity: 95 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequence: AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR
Target: VEGF-C
Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Growth Factor