Recombinant Human MADCAM1 Protein

Catalog Number: ABB-RP02808
Article Name: Recombinant Human MADCAM1 Protein
Biozol Catalog Number: ABB-RP02808
Supplier Catalog Number: RP02808
Alternative Catalog Number: ABB-RP02808-100UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Gln19-Gln317
Alternative Names: MAdCAM-1, MADCAM1, MACAM1
Mucosal addressin cell adhesion molecule-1 (MAdCAM-1) contributes to the recruitment of donor T cells into the mucosal tissues of the recipient after allogeneic hematopoietic stem cell transplantation (aHSCT). The aim of our study was to determine whether selected single nucleotide polymorphisms (SNPs) of the MADCAM1 gene are associated with development of serious complications after aHSCT.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 32.5 kDa
NCBI: 8174
UniProt: Q13477
Purity: 95 % as determined by SDS-PAGE. 95 % as determined by HPLC.
Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequence: QSLQVKPLQVEPPEPVVAVALGASRQLTCRLACADRGASVQWRGLDTSLGAVQSDTGRSVLTVRNASLSAAGTRVCVGSCGGRTFQHTVQLLVYAFPDQLTVSPAALVPGDPEVACTAHKVTPVDPNALSFSLLVGGQELEGAQALGPEVQEEEEEPQGDEDVLFRVTERWRLPPLGTPVPPALYCQATMRLPGLELSHRQAIPVLHSPTSPEPPDTTSPESPDTTSPESPDTTSQEPPDTTSPEPPDKTSPEPA
Target: MADCAM1
Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Application Notes: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein