Recombinant Human Angiopoietin-like 8/ANGPTL8 (22-198) Protein

Catalog Number: ABB-RP02831
Article Name: Recombinant Human Angiopoietin-like 8/ANGPTL8 (22-198) Protein
Biozol Catalog Number: ABB-RP02831
Supplier Catalog Number: RP02831
Alternative Catalog Number: ABB-RP02831-10UG, ABB-RP02831-50UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Ala22-Ala198
Alternative Names: Betatrophin,Angiopoietin-like protein 8,Lipasin,Angptl8,ANGPTL8
The protein specifically promotes pancreatic beta cell proliferation and beta cell mass expansion, thereby improving glucose tolerance. It promotes pancreatic beta cell proliferation without insulin resistance. Also it acts as a blood lipid regulator by regulating serum triglyceride levels and possibly by promoting ANGPTL3 cleavage. It interacts with ANGPTL3. It predominantly expressed in liver and also expressed in adipose tissues. The ability of the protein to induce pancreatic beta cell proliferation is promising in diabetes therapy. Betatrophin treatment could supply or replace insulin injections by increasing the number of insulin-producing cells in diabetes.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 46 kDa
NCBI: 55908
UniProt: Q6UXH0
Purity: 80 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Sequence: APMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA
Target: Angiopoietin-like 8/ANGPTL8
Application Dilute: Lyophilized from a 0.22 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Application Notes: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Growth Factor,Biosimilar Drug Targets