Recombinant Human Glycophorin-A/GYPA/CD235a protein

Catalog Number: ABB-RP02835
Article Name: Recombinant Human Glycophorin-A/GYPA/CD235a protein
Biozol Catalog Number: ABB-RP02835
Supplier Catalog Number: RP02835
Alternative Catalog Number: ABB-RP02835-50UG, ABB-RP02835-10UG, ABB-RP02835-100UG, ABB-RP02835-20UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Leu20-Glu91
Alternative Names: PAS-2, CD235a, GPA, GPErik, GpMiIII, GPSAT, GYPA, HGpMiIII, HGpMiV, HGpMiX, HGpMiXI, HGpSta(C), MNS, CD235a, MN
Granulomatosis with polyangiitis (GPA) presents a wide spectrum of manifestations from the common respiratory symptoms to infrequent neurological and cardiac complications. The challenge in diagnosis and management makes the rapidly progressive disorder one of the most challenging dilemmas in clinical medicine.The ultimate goal is an improved prognosis through outcome measures which assesses the disease control with minimal adverse effects of intensive immunosuppressive regimens, an integral part of the clinical approach to improve the quality of life of GPA patients.
Concentration: < 0.01 EU/µg of the protein by LAL method
Molecular Weight: 33.90 kDa
NCBI: 2993
UniProt: P02724
Purity: 95 % as determined by SDS-PAGE, 95 % as determined by HPLC.
Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequence: LSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE
Target: Glycophorin-A
Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Application Notes: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein