Recombinant Mouse L-Selectin/SELL/CD62L Protein, Human

Product Overview

• Article Name: Recombinant Mouse L-Selectin/SELL/CD62L Protein, Human
• Biozol Catalog Number: ABB-RP02841
• Supplier Catalog Number: RP02841
• Alternative Catalog Number: ABB-RP02841-50UG, ABB-RP02841-100UG
• Manufacturer: ABclonal
• Host: Human
• Category: Proteine/Peptide
• Species Reactivity: Mouse
• Immunogen: Asp29-Asn332
• Alternative Names: IPO5, KPNB3, RANBP5,L-selectin, CD62L

Product Description

L-selectin (CD62L) is a type-I transmembrane glycoprotein and cell adhesion molecule that is expressed on most circulating leukocytes. Since its identification in 1983, L-selectin has been extensively characterized as a tethering/rolling receptor. There is now mounting evidence in the literature to suggest that L-selectin plays a role in regulating monocyte protrusion during transendothelial migration (TEM).

Product Properties

• Concentration: < 0.01 EU/µg of the protein by LAL method.
• Molecular Weight: 33.92 KDa
• NCBI: 6402
• UniProt: P14151
• Purity: 90% as determined by reducing SDS-PAGE.
• Form: Lyophilized from 0.22µm filtered solution in PBS (pH 7.4).
• Sequence: DFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTS
• Target: IPO5, KPNB3, RANBP5

Application Notes

• Application Dilute: Lyophilized from 0.22µm filtered solution in PBS (pH 7.4).
• Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Bio-Markers & CD Antigens,Biosimilar Drug Targets