Recombinant Human PPAR gamma Protein, Virus

Catalog Number: ABB-RP02853
Article Name: Recombinant Human PPAR gamma Protein, Virus
Biozol Catalog Number: ABB-RP02853
Supplier Catalog Number: RP02853
Alternative Catalog Number: ABB-RP02853-50UG
Manufacturer: ABclonal
Host: Virus
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Met1-Tyr505
Alternative Names: GLM1, CIMT1, NR1C3, PPARG1, PPARG2, PPARG5, PPARgamma,PPARG
Peroxisome proliferator-activated receptor gamma (PPARG), a nuclear hormone receptor, plays a critical role in the lipid and glucose homeostasis, adipocyte differentiation, as well as intracellular insulin-signaling events. The peroxisome proliferator-activated receptor gamma (PPARgamma) regulates osteoblast and osteoclast differentiation, and is the molecular target of thiazolidinediones (TZDs), insulin sensitizers that enhance glucose utilization and adipocyte differentiation. Peroxisome proliferator-activated receptor gamma (PPARG) is a transcription factor involved in atherosclerosis and related diseases. Peroxisome proliferator-activated receptor gamma (PPARG) plays an important role in the pathogenesis and maintenance of essential hypertension (EH).The functional single nucleotide polymorphisms in peroxisome proliferator-activated receptor gamma (PPARG) gene were predicted to be correlated with the susceptibility of colorectal cancer (CRC).
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 85.4 kDa
Tag: N-His&amp;GST
NCBI: 5468
UniProt: P37231
Source: Baculovirus-Insect Cells
Purity: 95 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of 50mM Tris, 100mM NaCl, pH 7.4, 20% gly, 0.3mM DTT.
Sequence: MGETLGDSPIDPESDSFTDTLSANISQEMTMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFP
Target: PPAR gamma
Application Dilute: Lyophilized from a 0.22 µm filtered solution of 50mM Tris, 100mM NaCl, pH 7.4, 20% gly, 0.3mM DTT.
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein