Recombinant Mouse DLK1 Protein, Human

Product Overview

• Article Name: Recombinant Mouse DLK1 Protein, Human
• Biozol Catalog Number: ABB-RP02871
• Supplier Catalog Number: RP02871
• Alternative Catalog Number: ABB-RP02871-100UG
• Manufacturer: ABclonal
• Host: Human
• Category: Proteine/Peptide
• Species Reactivity: Mouse
• Immunogen: Ala24-Gln305
• Alternative Names: pG2, FA1, DLK, DLK1, DLK-1, Pref1, secredeltin, ZOG

Product Description

paternally inherited genetic defects of DLK1 were identified in four families with nonsyndromic CPP and a metabolic phenotype. DLK1 encodes a transmembrane protein that is important for adipose tissue homeostasis and neurogenesis and is located in the imprinted chromosome 14q32 region associated with Temple syndrome.

Product Properties

• Concentration: < 1 EU/µg of the protein by LAL method.
• Molecular Weight: 30.9 kDa
• NCBI: 13386
• UniProt: Q09163
• Purity: 95 % as determined by SDS-PAGE. 95 % as determined by HPLC.
• Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
• Sequence: AECDPPCDPQYGFCEADNVCRCHVGWEGPLCDKCVTAPGCVNGVCKEPWQCICKDGWDGKFCEIDVRACTSTPCANNGTCVDLEKGQYECSCTPGFSGKDCQHKAGPCVINGSPCQHGGACVDDEGQASHASCLCPPGFSGNFCEIVAATNSCTPNPCENDGVCTDIGGDFRCRCPAGFVDKTCSRPVSNCASGPCQNGGTCLQHTQVSFECLCKPPFMGPTCAKKRGASPVQVTHLPSGYGLTYRLTPGVHELP
• Target: DLK-1

Application Notes

• Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
• Application Notes: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein