Recombinant Human Plasma Kallikrein/KLKB1 Protein

Product Overview

• Article Name: Recombinant Human Plasma Kallikrein/KLKB1 Protein
• Biozol Catalog Number: ABB-RP02872
• Supplier Catalog Number: RP02872
• Alternative Catalog Number: ABB-RP02872-100UG
• Manufacturer: ABclonal
• Host: Human
• Category: Proteine/Peptide
• Species Reactivity: Human
• Immunogen: Gly20-Ala638
• Alternative Names: KLKB1,KLK3,PKK,PKKD,PPK

Product Description

Plasma kallikrein, also known as Fletcher factor or kallikrein B1 (KLKB1), is a serine endopeptidase, like its homologs tissue kallikrein and kallikrein-related peptidases (KLKs). Its physiological role is to catalyze the release of kinins and other vasoactive peptides.

Product Properties

• Concentration: < 1 EU/µg of the protein by LAL method.
• Molecular Weight: 70.3 kDa
• Tag: C-His
• NCBI: 3818
• UniProt: P03952
• Source: HEK293 cells
• Purity: 95 % as determined by SDS-PAGE. 95 % as determined by HPLC.
• Form: Lyophilized from a 0.22 µm filtered solution of 20mM NaAc,150mM NaCl,pH5.0.
• Sequence: GCLTQLYENAFFRGGDVASMYTPNAQYCQMRCTFHPRCLLFSFLPASSINDMEKRFGCFLKDSVTGTLPKVHRTGAVSGHSLKQCGHQISACHRDIYKGVDMRGVNFNVSKVSSVEECQKRCTNNIRCQFFSYATQTFHKAEYRNNCLLKYSPGGTPTAIKVLSNVESGFSLKPCALSEIGCHMNIFQHLAFSDVDVARVLTPDAFVCRTICTYHPNCLFFTFYTNVWKIESQRNVCLLKTSESGTPSSSTPQEN
• Target: Plasma Kallikrein/KLKB1

Application Notes

• Application Dilute: Lyophilized from a 0.22 µm filtered solution of 20mM NaAc,150mM NaCl,pH5.0.
• Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in 20mM NaAc,150mM NaCl,pH5.0.. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein