Recombinant Human IL-9 Protein

Catalog Number: ABB-RP02891
Article Name: Recombinant Human IL-9 Protein
Biozol Catalog Number: ABB-RP02891
Supplier Catalog Number: RP02891
Alternative Catalog Number: ABB-RP02891-10UG, ABB-RP02891-50UG, ABB-RP02891-100UG, ABB-RP02891-20UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Immunogen: Gln19-Ile144
Alternative Names: P40, HP40, IL-9,IL9
Interleukin 9, also known as IL-9, is a cytokine (cell signaling molecule) belonging to the group of interleukins. IL-9 is a cytokine that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents a
Concentration: <0.1EU/µg of the protein by LAL method.
Molecular Weight: 14.12 kDa
NCBI: 3578
UniProt: P15248
Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequence: QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI
Target: IL9
Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.