Recombinant Human Macrophage migration inhibitory factor/MIF Protein, E. coli

Catalog Number: ABB-RP02895
Article Name: Recombinant Human Macrophage migration inhibitory factor/MIF Protein, E. coli
Biozol Catalog Number: ABB-RP02895
Supplier Catalog Number: RP02895
Alternative Catalog Number: ABB-RP02895-10UG,ABB-RP02895-100UG,ABB-RP02895-50UG,ABB-RP02895-20UG
Manufacturer: ABclonal
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: (Met1-Ala115)
Alternative Names: GIF, GLIF, MMIF,MIF,GLIF,MMIF
MIF (or macrophage migration inhibitory factor) was the first lymphokine/cytokine to be recognized in the pregenomics era . Regardless, it is one of the least understood of all inflammatory mediators . Secretion occurs nonclassically via an ABCA1 transporter. The molecule consists of two alpha -helices and six beta -strands, four of which form a beta -sheet. The two remaining beta -strands interact with other MIF molecules, creating a trimer . Structure-function studies suggest MIF is bifunctional with segregated topology. The N- and C-termini mediate enzyme activity (in theory). Phenylpyruvate tautomerase activity (enol-to-keto) has been demonstrated and is dependent upon Pro at position 1. Amino acids 50 - 65 have also been suggested to contain thiol-protein oxidoreductase activity.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 13.32 kDa
NCBI: 4282
UniProt: P14174
Purity: 95 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of 20mM PB,150mM NaCl,pH7.4/20mM PB,150mM NaCl,pH7.4,50% glycerol
Sequence: MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
Target: Macrophage migion inhibitory factor/MIF
Application Dilute: Lyophilized from a 0.22 µm filtered solution of 20mM PB,150mM NaCl,pH7.4/20mM PB,150mM NaCl,pH7.4,50% glycerol
Application Notes: Cross-Reactivity: opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Cytokines & Cytokine receptors