Recombinant Human Argonaute-1/AGO1 Protein, Virus

Catalog Number: ABB-RP02933
Article Name: Recombinant Human Argonaute-1/AGO1 Protein, Virus
Biozol Catalog Number: ABB-RP02933
Supplier Catalog Number: RP02933
Alternative Catalog Number: ABB-RP02933-50UG
Manufacturer: ABclonal
Host: Virus
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Met1-Ala857
Alternative Names: Q99, EIF2C, hAgo1, EIF2C1, GERP95, NEDLBAS,AGO1
Protein argonaute-1, also known as eukaryotic translation initiation factor 2C 1, EIF2C1, and AGO1, is a member of the argonaute family and ago subfamily. Protein argonaute-1 in humans is encoded by the EIF2C1 gene. This gene is located on chromosome 1 in a cluster of closely related family members including argonaute 3, and argonaute 4. This genomic region is frequently lost in human cancers such as Wilms tumors, neuroblastoma, and carcinomas of the breast, liver, and colon. The human EIF2C1 gene is ubiquitously expressed at low to medium levels. Differential polyadenylation and splicing result in a complex transcriptional pattern.EIF2C1 protein contains onePAZ domain and onePiwi domain. It is required for RNA-mediated gene silencing (RNAi) and transcriptional gene silencing (TGS) of promoter regions which are complementary to bound short antigene RNAs (agRNAs). EIF2C1 binds to short RNAs such as microRNAs (miRNAs) or short interfering RNAs (siRNAs), and represses the translation of mRNAs which are complementary to them.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 99.5 kDa
Tag: N-His
NCBI: 26523
UniProt: Q9UL18
Source: Baculovirus-Insect Cells
Purity: 85 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of 50mM Tris, 100mM NaCl, 10% Gly, 0.5 PMSF, 0.5mM EDTA, pH 8.0.
Sequence: MEAGPSGAAAGAYLPPLQQVFQAPRRPGIGTVGKPIKLLANYFEVDIPKIDVYHYEVDIKPDKCPRRVNREVVEYMVQHFKPQIFGDRKPVYDGKKNIYTVTALPIGNERVDFEVTIPGEGKDRIFKVSIKWLAIVSWRMLHEALVSGQIPVPLESVQALDVAMRHLASMRYTPVGRSFFSPPEGYYHPLGGGREVWFGFHQSVRPAMWKMMLNIDVSATAFYKAQPVIEFMCEVLDIRNIDEQPKPLTDSQRVR
Target: Argonaute-1/AGO1
Application Dilute: Lyophilized from a 0.22 µm filtered solution of 50mM Tris, 100mM NaCl, 10% Gly, 0.5 PMSF, 0.5mM EDTA, pH 8.0.
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein