Recombinant Mouse uPAR/PLAUR/CD87 Protein, Human

Catalog Number: ABB-RP02934
Article Name: Recombinant Mouse uPAR/PLAUR/CD87 Protein, Human
Biozol Catalog Number: ABB-RP02934
Supplier Catalog Number: RP02934
Alternative Catalog Number: ABB-RP02934-100UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Mouse
Immunogen: Leu24-Gly298
Alternative Names: CD87,U-PAR,UPAR,URKR
The secreted recombinant human UPAR consists of 292 amino acids with a molecular weight of 32.8 kDa. Recombinant human UPAR migrates as an about 48 kDa band in SDS-PAGE under reducing conditions due to glycosylation.Urokinase plasminogen activator surface receptor (U-PAR) is also known as PLAUR, Monocyte activation antigen Mo3, CD antigen CD87. U-PAR contains three UPAR/Ly6 domains and is expressed in neurons of the rolandic area of the brain (at protein level). PLAUR / UPAR acts as a receptor for urokinase plasminogen activator and plays a role in localizing and promoting plasmin formation. Urokinase plasminogen activator (uPA) and/or its receptor (uPAR) are essential for metastasis, and overexpression of these molecules is strongly correlated with poor prognosis in a variety of malignant tumours. Furthermore, the analysis of U-PAR expression has a potential role in the diagnostic or prognostic work-up of several hematological malignancies, particularly acute leukemia and multiple myeloma.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 32.92 kDa
NCBI: 18793
UniProt: P35456
Purity: 95 % as determined by SDS-PAGE. 95 % as determined by HPLC.
Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Sequence: LQCMQCESNQSCLVEECALGQDLCRTTVLREWQDDRELEVVTRGCAHSEKTNRTMSYRMGSMIISLTETVCATNLCNRPRPGARGRAFPQGRYLECASCTSLDQSCERGREQSLQCRYPTEHCIEVVTLQSTERSLKDEDYTRGCGSLPGCPGTAGFHSNQTFHFLKCCNYTHCNGGPVLDLQSFPPNGFQCYSCEGNNTLGCSSEEASLINCRGPMNQCLVATGLDVLGNRSYTVRGCATASWCQGSHVADSFP
Target: uPAR/PLAUR/CD87
Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4. Contact us for customized product form or formulation.
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein