Recombinant Mouse Leptin receptor/LEP-R/CD295 Protein, Human

Catalog Number: ABB-RP02959
Article Name: Recombinant Mouse Leptin receptor/LEP-R/CD295 Protein, Human
Biozol Catalog Number: ABB-RP02959
Supplier Catalog Number: RP02959
Alternative Catalog Number: ABB-RP02959-10UG,ABB-RP02959-50UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Mouse
Immunogen: Leu22-Gly839
Alternative Names: Leptin receptor, LEP-R, HuB219, OB receptor, OB-R, CD295, LEPR, DB, OBR
This protein is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes. This protein is a secreted endocrine factor that functions as a major metabolic regulator. The protein stimulates the uptake of glucose in adipose tissue.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 93 kDa
Tag: C-His
NCBI: 16847
UniProt: P48356
Source: HEK293 cells
Purity: 90 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequence: LNLAYPISPWKFKLFCGPPNTTDDSFLSPAGAPNNASALKGASEAIVEAKFNSSGIYVPELSKTVFHCCFGNEQGQNCSALTDNTEGKTLASVVKASVFRQLGVNWDIECWMKGDLTLFICHMEPLPKNPFKNYDSKVHLLYDLPEVIDDSPLPPLKDSFQTVQCNCSLRGCECHVPVPRAKLNYALLMYLEITSAGVSFQSPLMSLQPMLVVKPDPPLGLHMEVTDDGNLKISWDSQTMAPFPLQYQVKYLENS
Target: LEPR
Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Application Notes: Cross-Reactivity: Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Bio-Markers & CD Antigens