Recombinant Human Annexin A6/ANXA6 Protein, E. coli

Catalog Number: ABB-RP02985
Article Name: Recombinant Human Annexin A6/ANXA6 Protein, E. coli
Biozol Catalog Number: ABB-RP02985
Supplier Catalog Number: RP02985
Alternative Catalog Number: ABB-RP02985-10UG
Manufacturer: ABclonal
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Ala2-Asp673
Alternative Names: Annexin A6, 67 kDa Calelectrin, Annexin VI, Annexin-6, Calphobindin-II, CPB-II, Chromobindin-20, Lipocortin VI, Protein III, p68, p70, ANXA6, ANX6
Annexin A6 (ANAX6) belongs to a family of calcium-dependent membrane and phospholipid binding proteins. Annexin A6 is a secreted protein and locates on the cell surface. Annexin A6 contains 8 annexin repeats separated by linking sequences of variable lengths. A pair of annexin repeats may form one binding site for calcium and phospholipid. ANXA6 is involved in the regulation of the release of Ca2+ from intracellular stores and may be associated with CD21. In addition, ANXA6 has been implicated in mediating the endosome aggregation and vesicle fusion in secreting epithelia during exocytosis.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 76.9 kDa
NCBI: 309
UniProt: P08133
Purity: 95 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4.
Sequence: AKPAQGAKYRGSIHDFPGFDPNQDAEALYTAMKGFGSDKEAILDIITSRSNRQRQEVCQSYKSLYGKDLIADLKYELTGKFERLIVGLMRPPAYCDAKEIKDAISGIGTDEKCLIEILASRTNEQMHQLVAAYKDAYERDLEADIIGDTSGHFQKMLVVLLQGTREEDDVVSEDLVQQDVQDLYEAGELKWGTDEAQFIYILGNRSKQHLRLVFDEYLKTTGKPIEASIRGELSGDFEKLMLAVVKCIRSTPEYF
Target: ANXA6
Application Dilute: Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4.
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein