Recombinant Human Ezrin/EZR Protein, E. coli

Catalog Number: ABB-RP02986LQ
Article Name: Recombinant Human Ezrin/EZR Protein, E. coli
Biozol Catalog Number: ABB-RP02986LQ
Supplier Catalog Number: RP02986LQ
Alternative Catalog Number: ABB-RP02986LQ-50UG
Manufacturer: ABclonal
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Immunogen: Met1-Leu586
Alternative Names: Ezrin, Cytovillin, Villin-2, p81, EZR, VIL2
Ezrin is expressed in cerebral cortex, basal ganglia, hippocampus, hypophysis, and optic nerve. The N-terminus of ezrin contains a FERM domain which is further subdivided into three subdomains. The C-terminus contain a ERM domain. As a member of the ERM protein family, Ezrin serves as an intermediate between the plasma membrane and the actin cytoskeleton. It plays a key role in cell surface structure adhesion, migration, and organization. Ezrin probably involved in connections of major cytoskeletal structures to the plasma membrane. The N-terminal FERM domain strongly binds sodium-hydrogen exchanger regulatory factor (NHERF) proteins (involving long-range allostery). The C-terminal binds to actin, phosphatidylinositol bis-phosphate (PIP2) and membrane proteins like CD44 and ICAM-2. In epithelial cells, Ezrin is required for the formation of microvilli and membrane ruffles on the apical pole. Along with PLEKHG6, Ezrin is required for normal macropinocytosis.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 69.4 kDa
NCBI: 7430
UniProt: P15311
Purity: 95 % as determined by SDS-PAGE.
Form: Supplied as a 0.2 µm filtered solution of 10mM HEPES, pH 7.4.
Sequence: MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLKLDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKF
Target: Ezrin/EZR
Application Dilute: Supplied as a 0.2 µm filtered solution of 10mM HEPES, pH 7.4.
Application Notes: ResearchArea: Other Recombinant Protein