Recombinant Mouse Cathepsin B Protein, Human

Catalog Number: ABB-RP02994
Article Name: Recombinant Mouse Cathepsin B Protein, Human
Biozol Catalog Number: ABB-RP02994
Supplier Catalog Number: RP02994
Alternative Catalog Number: ABB-RP02994-50UG
Manufacturer: ABclonal
Host: Human
Category: Proteine/Peptide
Species Reactivity: Mouse
Immunogen: His18-Phe339
Alternative Names: Cathepsin B, 3.4.22.1, APP secretase, APPS, Cathepsin B1,CTSB
Recombinant Mouse Cathepsin B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His18-Phe339) of mouse Cathepsin B (Accession NP_031824.1) fused with a 6*His tag at the C-terminus.
Concentration: < 1 EU/µg of the protein by LAL method.
Molecular Weight: 36.6 kDa
Tag: C-His
NCBI: 13030
UniProt: P10605
Source: HEK293 cells
Purity: 95 % as determined by SDS-PAGE.
Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Sequence: HDKPSFHPLSDDLINYINKQNTTWQAGRNFYNVDISYLKKLCGTVLGGPKLPGRVAFGEDIDLPETFDAREQWSNCPTIGQIRDQGSCGSCWAFGAVEAISDRTCIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWSFWTKKGLVSGGVYNSHVGCLPYTIPPCEHHVNGSRPPCTGEGDTPRCNKSCEAGYSPSYKEDKHFGYTSYSVSNSVKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAG
Target: Cathepsin B
Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles., ResearchArea: Other Recombinant Protein
Recombinant Mouse Cathepsin B Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.