Recombinant Mouse Cathepsin B Protein, Human

Product Overview

• Article Name: Recombinant Mouse Cathepsin B Protein, Human
• Biozol Catalog Number: ABB-RP02994
• Supplier Catalog Number: RP02994
• Alternative Catalog Number: ABB-RP02994-50UG
• Manufacturer: ABclonal
• Host: Human
• Category: Proteine/Peptide
• Species Reactivity: Mouse
• Immunogen: His18-Phe339
• Alternative Names: Cathepsin B, 3.4.22.1, APP secretase, APPS, Cathepsin B1,CTSB

Product Description

Recombinant Mouse Cathepsin B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His18-Phe339) of mouse Cathepsin B (Accession NP_031824.1) fused with a 6*His tag at the C-terminus.

Product Properties

• Concentration: < 1 EU/µg of the protein by LAL method.
• Molecular Weight: 36.6 kDa
• Tag: C-His
• NCBI: 13030
• UniProt: P10605
• Source: HEK293 cells
• Purity: 95 % as determined by SDS-PAGE.
• Form: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
• Sequence: HDKPSFHPLSDDLINYINKQNTTWQAGRNFYNVDISYLKKLCGTVLGGPKLPGRVAFGEDIDLPETFDAREQWSNCPTIGQIRDQGSCGSCWAFGAVEAISDRTCIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWSFWTKKGLVSGGVYNSHVGCLPYTIPPCEHHVNGSRPPCTGEGDTPRCNKSCEAGYSPSYKEDKHFGYTSYSVSNSVKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAG
• Target: Cathepsin B

Application Notes

• Application Dilute: Lyophilized from a 0.22 µm filtered solution of PBS, pH 7.4.
• Application Notes: Cross-Reactivity: Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage,it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA,5% HSA,10% FBS or 5% Trehalose),and aliquot the reconstituted protein solution to minimize free-thaw cycles. ResearchArea: Other Recombinant Protein